SR140 polyclonal antibody
  • SR140 polyclonal antibody

SR140 polyclonal antibody

Ref: AB-PAB23130
SR140 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SR140.
Información adicional
Size 100 uL
Gene Name SR140
Gene Alias KIAA0332|MGC133197
Gene Description U2-associated SR140 protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq EEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SR140.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23350
Iso type IgG

Enviar uma mensagem


SR140 polyclonal antibody

SR140 polyclonal antibody