DOCK3 polyclonal antibody
  • DOCK3 polyclonal antibody

DOCK3 polyclonal antibody

Ref: AB-PAB23128
DOCK3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DOCK3.
Información adicional
Size 100 uL
Gene Name DOCK3
Gene Alias KIAA0299|MOCA|PBP
Gene Description dedicator of cytokinesis 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq FEVVDSDQISVSDLYKMHLSSRQSVQQSTSQVDTMRPRHGETCRMPVPHHFFLSLKSFTYNTIGEDTDVFFSLYDMREGKQISERFLVRLNKNG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DOCK3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1795
Iso type IgG

Enviar uma mensagem


DOCK3 polyclonal antibody

DOCK3 polyclonal antibody