SPAG16 polyclonal antibody
  • SPAG16 polyclonal antibody

SPAG16 polyclonal antibody

Ref: AB-PAB23127
SPAG16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPAG16.
Información adicional
Size 100 uL
Gene Name SPAG16
Gene Alias DKFZp666P1710|FLJ22724|FLJ37717|MGC87036|PF20|WDR29
Gene Description sperm associated antigen 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPAG16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79582
Iso type IgG

Enviar uma mensagem


SPAG16 polyclonal antibody

SPAG16 polyclonal antibody