MMADHC polyclonal antibody
  • MMADHC polyclonal antibody

MMADHC polyclonal antibody

Ref: AB-PAB23126
MMADHC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MMADHC.
Información adicional
Size 100 uL
Gene Name MMADHC
Gene Alias C2orf25|CL25022
Gene Description methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq EVLLEKFINGAKEICYALRAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVIRHSLWGTHVVVGSIFTNAT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MMADHC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27249
Iso type IgG

Enviar uma mensagem


MMADHC polyclonal antibody

MMADHC polyclonal antibody