POLR2B polyclonal antibody
  • POLR2B polyclonal antibody

POLR2B polyclonal antibody

Ref: AB-PAB23123
POLR2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant POLR2B.
Información adicional
Size 100 uL
Gene Name POLR2B
Gene Alias POL2RB|RPB2|hRPB140|hsRPB2
Gene Description polymerase (RNA) II (DNA directed) polypeptide B, 140kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq FFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human POLR2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5431
Iso type IgG

Enviar uma mensagem


POLR2B polyclonal antibody

POLR2B polyclonal antibody