KIAA1128 polyclonal antibody
  • KIAA1128 polyclonal antibody

KIAA1128 polyclonal antibody

Ref: AB-PAB23120
KIAA1128 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1128.
Información adicional
Size 100 uL
Gene Name KIAA1128
Gene Alias FLJ14262|FLJ25809|Gcap14|bA486O22.1
Gene Description KIAA1128
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NVECDNMNRFDRPDRNVRQPQEGFWKRPPQRWSGQEHYHLSHPDHYHHHGKSDLSRGSPYRESPLGHFESYGGMPFFQAQKMFVDVPENTVILDEMT
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1128.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54462
Iso type IgG

Enviar uma mensagem


KIAA1128 polyclonal antibody

KIAA1128 polyclonal antibody