TMCO6 polyclonal antibody
  • TMCO6 polyclonal antibody

TMCO6 polyclonal antibody

Ref: AB-PAB23117
TMCO6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMCO6.
Información adicional
Size 100 uL
Gene Name TMCO6
Gene Alias FLJ39769|PRO1580
Gene Description transmembrane and coiled-coil domains 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EREAALRKARREQQLVSKRLLRNDAPEEAGEGCVAAILGETEVQQFLRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMCO6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55374
Iso type IgG

Enviar uma mensagem


TMCO6 polyclonal antibody

TMCO6 polyclonal antibody