RANBP3L polyclonal antibody
  • RANBP3L polyclonal antibody

RANBP3L polyclonal antibody

Ref: AB-PAB23116
RANBP3L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RANBP3L.
Información adicional
Size 100 uL
Gene Name RANBP3L
Gene Alias FLJ25422
Gene Description RAN binding protein 3-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MTTIPRKGSSHLPGSLHTCKLKLQEDRRQQEKSVIAQPIFVFEKGEQTFKRPAEDTLYEAAEPECNGFPRKRVRSSSFTFH
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RANBP3L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 202151
Iso type IgG

Enviar uma mensagem


RANBP3L polyclonal antibody

RANBP3L polyclonal antibody