ARL13A polyclonal antibody
  • ARL13A polyclonal antibody

ARL13A polyclonal antibody

Ref: AB-PAB23102
ARL13A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARL13A.
Información adicional
Size 100 uL
Gene Name ARL13A
Gene Alias ARL13|dJ341D10.2
Gene Description ADP-ribosylation factor-like 13A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EETRRNVTIPIIGLNNSGKTVLVEAFQKLLPSKTDHCMKSELTTLLLDEYELSIYDLNGDLKGREAWPNYYAQAHGLVFVLDS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARL13A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 392509
Iso type IgG

Enviar uma mensagem


ARL13A polyclonal antibody

ARL13A polyclonal antibody