FAM44A polyclonal antibody
  • FAM44A polyclonal antibody

FAM44A polyclonal antibody

Ref: AB-PAB23099
FAM44A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM44A.
Información adicional
Size 100 uL
Gene Name FAM44A
Gene Alias FLJ33215|KIAA1327
Gene Description family with sequence similarity 44, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PQVEKAVHEFLATLNHKEEGSGNTAPDDEKPDTSLITQGVPTPGPSANVANDAMSILETITSLNQEASAARASTETSNAKTSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM44A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 259282
Iso type IgG

Enviar uma mensagem


FAM44A polyclonal antibody

FAM44A polyclonal antibody