BANK1 polyclonal antibody
  • BANK1 polyclonal antibody

BANK1 polyclonal antibody

Ref: AB-PAB23096
BANK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BANK1.
Información adicional
Size 100 uL
Gene Name BANK1
Gene Alias BANK|FLJ20706|FLJ34204
Gene Description B-cell scaffold protein with ankyrin repeats 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RHGHKELKKIFEDFSIQEIDINNEQENDYEEDIASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BANK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55024
Iso type IgG

Enviar uma mensagem


BANK1 polyclonal antibody

BANK1 polyclonal antibody