CEP70 polyclonal antibody
  • CEP70 polyclonal antibody

CEP70 polyclonal antibody

Ref: AB-PAB23087
CEP70 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CEP70.
Información adicional
Size 100 uL
Gene Name CEP70
Gene Alias BITE|FLJ13036
Gene Description centrosomal protein 70kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KKAEDTEKKDEPSKYNQQQALIDQRYFQVLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CEP70.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80321
Iso type IgG

Enviar uma mensagem


CEP70 polyclonal antibody

CEP70 polyclonal antibody