TBC1D14 polyclonal antibody
  • TBC1D14 polyclonal antibody

TBC1D14 polyclonal antibody

Ref: AB-PAB23085
TBC1D14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TBC1D14.
Información adicional
Size 100 uL
Gene Name TBC1D14
Gene Alias FLJ32400|KIAA1322
Gene Description TBC1 domain family, member 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq FTNVTLSSIKETRGLHQQDCVHEAEEGSKLKILGPFSNFFARNLLARKQSARLDKHNDLGWKLFGKAPLRENAQKDSKRIQKEYED
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TBC1D14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57533
Iso type IgG

Enviar uma mensagem


TBC1D14 polyclonal antibody

TBC1D14 polyclonal antibody