DNAJC13 polyclonal antibody
  • DNAJC13 polyclonal antibody

DNAJC13 polyclonal antibody

Ref: AB-PAB23084
DNAJC13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAJC13.
Información adicional
Size 100 uL
Gene Name DNAJC13
Gene Alias FLJ25863|KIAA0678|RME8
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VTPGGFDQINPATNRVLCSYDYRNIEGFVDLSDYQGGFCILYGGFSRLHLFASEQREEIIKSAIDHAGNYIGISLRIRKEPLEFEQYLNLRF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAJC13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23317
Iso type IgG

Enviar uma mensagem


DNAJC13 polyclonal antibody

DNAJC13 polyclonal antibody