CWF19L1 polyclonal antibody
  • CWF19L1 polyclonal antibody

CWF19L1 polyclonal antibody

Ref: AB-PAB23076
CWF19L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CWF19L1.
Información adicional
Size 100 uL
Gene Name CWF19L1
Gene Alias FLJ10998
Gene Description CWF19-like 1, cell cycle control (S. pombe)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KDVSSLRMMLCTTSQFKGVDILLTSPWPKCVGNFGNSSGEVDTKKCGSALVSSLATGLKPRYHFAALEKTYYERLPYRNHIILQENAQHATRF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CWF19L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55280
Iso type IgG

Enviar uma mensagem


CWF19L1 polyclonal antibody

CWF19L1 polyclonal antibody