SPATA18 polyclonal antibody
  • SPATA18 polyclonal antibody

SPATA18 polyclonal antibody

Ref: AB-PAB23072
SPATA18 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPATA18.
Información adicional
Size 100 uL
Gene Name SPATA18
Gene Alias FLJ32906
Gene Description spermatogenesis associated 18 homolog (rat)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTAAAQEGGRNDGVETIKSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPATA18.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 132671
Iso type IgG

Enviar uma mensagem


SPATA18 polyclonal antibody

SPATA18 polyclonal antibody