AP2M1 polyclonal antibody
  • AP2M1 polyclonal antibody

AP2M1 polyclonal antibody

Ref: AB-PAB23071
AP2M1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AP2M1.
Información adicional
Size 100 uL
Gene Name AP2M1
Gene Alias AP50|CLAPM1|mu2
Gene Description adaptor-related protein complex 2, mu 1 subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AP2M1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1173
Iso type IgG

Enviar uma mensagem


AP2M1 polyclonal antibody

AP2M1 polyclonal antibody