TAMM41 polyclonal antibody
  • TAMM41 polyclonal antibody

TAMM41 polyclonal antibody

Ref: AB-PAB23069
TAMM41 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TAMM41.
Información adicional
Size 100 uL
Gene Name TAMM41
Gene Alias C3orf31|TAM41
Gene Description TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TAMM41.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 132001
Iso type IgG

Enviar uma mensagem


TAMM41 polyclonal antibody

TAMM41 polyclonal antibody