NGLY1 polyclonal antibody
  • NGLY1 polyclonal antibody

NGLY1 polyclonal antibody

Ref: AB-PAB23068
NGLY1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NGLY1.
Información adicional
Size 100 uL
Gene Name NGLY1
Gene Alias FLJ11005|FLJ12409|PNG1
Gene Description N-glycanase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ISDEDFLLLELLHWFKEEFFHWVNNVLCSKCGGQTRSRDRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEKLLETRCGR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NGLY1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55768
Iso type IgG

Enviar uma mensagem


NGLY1 polyclonal antibody

NGLY1 polyclonal antibody