DNAH1 polyclonal antibody
  • DNAH1 polyclonal antibody

DNAH1 polyclonal antibody

Ref: AB-PAB23063
DNAH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAH1.
Información adicional
Size 100 uL
Gene Name DNAH1
Gene Alias DNAHC1|HDHC7|HL-11|HL11|XLHSRF-1
Gene Description dynein, axonemal, heavy chain 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25981
Iso type IgG

Enviar uma mensagem


DNAH1 polyclonal antibody

DNAH1 polyclonal antibody