PPP1R21 polyclonal antibody
  • PPP1R21 polyclonal antibody

PPP1R21 polyclonal antibody

Ref: AB-PAB23058
PPP1R21 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPP1R21.
Información adicional
Size 100 uL
Gene Name PPP1R21
Gene Alias CCDC128|KLRAQ1
Gene Description protein phosphatase 1, regulatory subunit 21
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq WMLEAQLAKIKLEKENQRIADKLKNTGSAQLVGLAQENAAVSNTAGQDEATAKAVLEPIQSTSLIGTLTRTSDSEVPDVESREDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPP1R21.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 129285
Iso type IgG

Enviar uma mensagem


PPP1R21 polyclonal antibody

PPP1R21 polyclonal antibody