ZNF638 polyclonal antibody
  • ZNF638 polyclonal antibody

ZNF638 polyclonal antibody

Ref: AB-PAB23057
ZNF638 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF638.
Información adicional
Size 100 uL
Gene Name ZNF638
Gene Alias DKFZp686P1231|MGC26130|MGC90196|NP220|ZFML|Zfp638
Gene Description zinc finger protein 638
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GLLKPTSARSGLAESSSKFKPTQSSLTRGGSGRISALQGKLSKLDYRDITKQSQETEARPSIMKRDDSNNKTLAEQNTKNPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF638.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27332
Iso type IgG

Enviar uma mensagem


ZNF638 polyclonal antibody

ZNF638 polyclonal antibody