TTC7A polyclonal antibody
  • TTC7A polyclonal antibody

TTC7A polyclonal antibody

Ref: AB-PAB23056
TTC7A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTC7A.
Información adicional
Size 100 uL
Gene Name TTC7A
Gene Alias MGC131720|MGC134830|TTC7
Gene Description tetratricopeptide repeat domain 7A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TSRHLKGCHPLDYELTYFLEAALQSAYVKNLKKGNIVKGMRELREVLRTVETKATQNFKVMAAKHLAGVLLHSLSEECYWSPLSHPLPEFMGKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTC7A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57217
Iso type IgG

Enviar uma mensagem


TTC7A polyclonal antibody

TTC7A polyclonal antibody