SLC9A3 polyclonal antibody
  • SLC9A3 polyclonal antibody

SLC9A3 polyclonal antibody

Ref: AB-PAB23047
SLC9A3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC9A3.
Información adicional
Size 100 uL
Gene Name SLC9A3
Gene Alias MGC126718|MGC126720|NHE3
Gene Description solute carrier family 9 (sodium/hydrogen exchanger), member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC9A3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6550
Iso type IgG

Enviar uma mensagem


SLC9A3 polyclonal antibody

SLC9A3 polyclonal antibody