LRP2BP polyclonal antibody
  • LRP2BP polyclonal antibody

LRP2BP polyclonal antibody

Ref: AB-PAB23045
LRP2BP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRP2BP.
Información adicional
Size 100 uL
Gene Name LRP2BP
Gene Alias DKFZp761O0113|FLJ44965
Gene Description LRP2 binding protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GNLVEYYYKMKFFTKCVAFSKRIADYDEVHDIPMIAQVTDCLPEFIGRGMAMASFYHARCLQLGLGITRDETTAKHYYSKACRLNPALADELHSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRP2BP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55805
Iso type IgG

Enviar uma mensagem


LRP2BP polyclonal antibody

LRP2BP polyclonal antibody