STT3B polyclonal antibody
  • STT3B polyclonal antibody

STT3B polyclonal antibody

Ref: AB-PAB23044
STT3B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STT3B.
Información adicional
Size 100 uL
Gene Name STT3B
Gene Alias FLJ90106|SIMP|STT3-B
Gene Description STT3, subunit of the oligosaccharyltransferase complex, homolog B (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STT3B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 201595
Iso type IgG

Enviar uma mensagem


STT3B polyclonal antibody

STT3B polyclonal antibody