CXXC4 polyclonal antibody
  • CXXC4 polyclonal antibody

CXXC4 polyclonal antibody

Ref: AB-PAB23036
CXXC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CXXC4.
Información adicional
Size 100 uL
Gene Name CXXC4
Gene Alias IDAX|MGC149872
Gene Description CXXC finger 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GSRTSMHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CXXC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80319
Iso type IgG

Enviar uma mensagem


CXXC4 polyclonal antibody

CXXC4 polyclonal antibody