C11orf51 polyclonal antibody
  • C11orf51 polyclonal antibody

C11orf51 polyclonal antibody

Ref: AB-PAB23034
C11orf51 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C11orf51.
Información adicional
Size 100 uL
Gene Name C11orf51
Gene Alias DKFZp564M082|HSPC020
Gene Description chromosome 11 open reading frame 51
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEED
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C11orf51.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25906
Iso type IgG

Enviar uma mensagem


C11orf51 polyclonal antibody

C11orf51 polyclonal antibody