C11orf58 polyclonal antibody
  • C11orf58 polyclonal antibody

C11orf58 polyclonal antibody

Ref: AB-PAB23031
C11orf58 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C11orf58.
Información adicional
Size 100 uL
Gene Name C11orf58
Gene Alias DKFZp686N0232|IMAGE145052|MGC117265|SMAP
Gene Description chromosome 11 open reading frame 58
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq INEELESQYQQSMDSKLSGRYRRHCGLGFSEVEDHDGEGDVAGDDDDDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C11orf58.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10944
Iso type IgG

Enviar uma mensagem


C11orf58 polyclonal antibody

C11orf58 polyclonal antibody