HNRNPA0 polyclonal antibody
  • HNRNPA0 polyclonal antibody

HNRNPA0 polyclonal antibody

Ref: AB-PAB23029
HNRNPA0 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HNRNPA0.
Información adicional
Size 100 uL
Gene Name HNRNPA0
Gene Alias HNRPA0
Gene Description heterogeneous nuclear ribonucleoprotein A0
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq RGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGG
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HNRNPA0.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10949
Iso type IgG

Enviar uma mensagem


HNRNPA0 polyclonal antibody

HNRNPA0 polyclonal antibody