MATR3 polyclonal antibody
  • MATR3 polyclonal antibody

MATR3 polyclonal antibody

Ref: AB-PAB23027
MATR3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MATR3.
Información adicional
Size 100 uL
Gene Name MATR3
Gene Alias DKFZp686K0542|DKFZp686K23100|KIAA0723|MGC9105
Gene Description matrin 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEEKRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDDRLRDGERCRDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MATR3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9782
Iso type IgG

Enviar uma mensagem


MATR3 polyclonal antibody

MATR3 polyclonal antibody