CCDC147 polyclonal antibody
  • CCDC147 polyclonal antibody

CCDC147 polyclonal antibody

Ref: AB-PAB23024
CCDC147 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC147.
Información adicional
Size 100 uL
Gene Name CCDC147
Gene Alias C10orf80|FLJ35908|MGC126475|bA127L20.4|bA127L20.5|bA554P13.1
Gene Description coiled-coil domain containing 147
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC147.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 159686
Iso type IgG

Enviar uma mensagem


CCDC147 polyclonal antibody

CCDC147 polyclonal antibody