CUEDC2 polyclonal antibody
  • CUEDC2 polyclonal antibody

CUEDC2 polyclonal antibody

Ref: AB-PAB23022
CUEDC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CUEDC2.
Información adicional
Size 100 uL
Gene Name CUEDC2
Gene Alias C10orf66|MGC2491|bA18I14.5
Gene Description CUE domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq DLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPI
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CUEDC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79004
Iso type IgG

Enviar uma mensagem


CUEDC2 polyclonal antibody

CUEDC2 polyclonal antibody