FLJ20184 polyclonal antibody
  • FLJ20184 polyclonal antibody

FLJ20184 polyclonal antibody

Ref: AB-PAB23017
FLJ20184 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FLJ20184.
Información adicional
Size 100 uL
Gene Name FLJ20184
Gene Alias -
Gene Description hypothetical protein FLJ20184
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEYNQKLQEKMTPQGECSVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FLJ20184.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54848
Iso type IgG

Enviar uma mensagem


FLJ20184 polyclonal antibody

FLJ20184 polyclonal antibody