CXXC5 polyclonal antibody
  • CXXC5 polyclonal antibody

CXXC5 polyclonal antibody

Ref: AB-PAB23016
CXXC5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CXXC5.
Información adicional
Size 100 uL
Gene Name CXXC5
Gene Alias HSPC195
Gene Description CXXC finger 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAGVFLAESALHMAGLAEYPMQGELASAISSGKKKRK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CXXC5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51523
Iso type IgG

Enviar uma mensagem


CXXC5 polyclonal antibody

CXXC5 polyclonal antibody