SPATA5 polyclonal antibody
  • SPATA5 polyclonal antibody

SPATA5 polyclonal antibody

Ref: AB-PAB23003
SPATA5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPATA5.
Información adicional
Size 100 uL
Gene Name SPATA5
Gene Alias AFG2|SPAF
Gene Description spermatogenesis associated 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IQVQPLVGAVLQAEEMDVALSDKDMEINEEELTGCILRKLDGKIVLPGNFLYCTFYGRPYKLQVLRVKGADGMILGGPQSDSDTDAQRMA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPATA5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 166378
Iso type IgG

Enviar uma mensagem


SPATA5 polyclonal antibody

SPATA5 polyclonal antibody