DNAH6 polyclonal antibody
  • DNAH6 polyclonal antibody

DNAH6 polyclonal antibody

Ref: AB-PAB22996
DNAH6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAH6.
Información adicional
Size 100 uL
Gene Name DNAH6
Gene Alias Dnahc6|HL-2|HL2
Gene Description dynein, axonemal, heavy chain 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPWERIIPTFKYNRDVP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAH6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1768
Iso type IgG

Enviar uma mensagem


DNAH6 polyclonal antibody

DNAH6 polyclonal antibody