ATG4A polyclonal antibody
  • ATG4A polyclonal antibody

ATG4A polyclonal antibody

Ref: AB-PAB22992
ATG4A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATG4A.
Información adicional
Size 100 uL
Gene Name ATG4A
Gene Alias APG4A|AUTL2
Gene Description ATG4 autophagy related 4 homolog A (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATG4A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 115201
Iso type IgG

Enviar uma mensagem


ATG4A polyclonal antibody

ATG4A polyclonal antibody