FAM207A polyclonal antibody
  • FAM207A polyclonal antibody

FAM207A polyclonal antibody

Ref: AB-PAB22988
FAM207A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM207A.
Información adicional
Size 100 uL
Gene Name FAM207A
Gene Alias PRED56|C21orf70
Gene Description family with sequence similarity 207, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq AFINTNIFARTKIDPSALVQKLELDVRSVTSVRRGEAGSSARSVPSIRRGAEAKTVLPKKEKMKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM207A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85395
Iso type IgG

Enviar uma mensagem


FAM207A polyclonal antibody

FAM207A polyclonal antibody