GNL3L polyclonal antibody
  • GNL3L polyclonal antibody

GNL3L polyclonal antibody

Ref: AB-PAB22980
GNL3L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GNL3L.
Información adicional
Size 100 uL
Gene Name GNL3L
Gene Alias FLJ10613
Gene Description guanine nucleotide binding protein-like 3 (nucleolar)-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq HFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEVFDIED
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GNL3L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54552
Iso type IgG

Enviar uma mensagem


GNL3L polyclonal antibody

GNL3L polyclonal antibody