LARP2 polyclonal antibody
  • LARP2 polyclonal antibody

LARP2 polyclonal antibody

Ref: AB-PAB22975
LARP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LARP2.
Información adicional
Size 100 uL
Gene Name LARP2
Gene Alias DKFZp686L13217|MGC117277|MGC75174
Gene Description La ribonucleoprotein domain family, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KHKWVPLHLDVVRSESQERPGSRNSSRCQPEANKPTHNNRRNDTRSWKRDREKRDDQDDVSSVRSEGGNIRGSF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LARP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55132
Iso type IgG

Enviar uma mensagem


LARP2 polyclonal antibody

LARP2 polyclonal antibody