PLEKHG4B polyclonal antibody
  • PLEKHG4B polyclonal antibody

PLEKHG4B polyclonal antibody

Ref: AB-PAB22973
PLEKHG4B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLEKHG4B.
Información adicional
Size 100 uL
Gene Name PLEKHG4B
Gene Alias FLJ43173|KIAA1909
Gene Description pleckstrin homology domain containing, family G (with RhoGef domain) member 4B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YDRVDEEVHRLVLTSNNRLQQLEHLRELASLLEGNDQQSCQKGLQLAKENPQRTEEMVQDFRRGLSAVVSQAECREGELARWTRSSELCETVS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLEKHG4B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 153478
Iso type IgG

Enviar uma mensagem


PLEKHG4B polyclonal antibody

PLEKHG4B polyclonal antibody