CCDC152 polyclonal antibody
  • CCDC152 polyclonal antibody

CCDC152 polyclonal antibody

Ref: AB-PAB22968
CCDC152 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC152.
Información adicional
Size 100 uL
Gene Name CCDC152
Gene Alias -
Gene Description coiled-coil domain containing 152
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KEMEISELNAKLRSQEKEKQNEIIKLQLEFDAKLARVQTKSKSYQDSTVLPQSIYRRKLQHFQEEKNKEIAILRNTIRDLEQRLSVGKDSHLKRRRF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC152.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100129792
Iso type IgG

Enviar uma mensagem


CCDC152 polyclonal antibody

CCDC152 polyclonal antibody