ANKRD23 polyclonal antibody
  • ANKRD23 polyclonal antibody

ANKRD23 polyclonal antibody

Ref: AB-PAB22965
ANKRD23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD23.
Información adicional
Size 100 uL
Gene Name ANKRD23
Gene Alias DARP|FLJ32449|MARP3|MGC129593
Gene Description ankyrin repeat domain 23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq KRLRHRVPPRKPEPLVKPQSQAQVEPVGLEMFLKAAAENQEYLIDKYLTDGGDPNAHDKLHRTALHWAC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200539
Iso type IgG

Enviar uma mensagem


ANKRD23 polyclonal antibody

ANKRD23 polyclonal antibody