CRIP3 polyclonal antibody
  • CRIP3 polyclonal antibody

CRIP3 polyclonal antibody

Ref: AB-PAB22964
CRIP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CRIP3.
Información adicional
Size 100 uL
Gene Name CRIP3
Gene Alias TLP|TLP-A|bA480N24.2
Gene Description cysteine-rich protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CYGALFGPRGVNIGGVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSLGRNWHRP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CRIP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 401262
Iso type IgG

Enviar uma mensagem


CRIP3 polyclonal antibody

CRIP3 polyclonal antibody