ZNF654 polyclonal antibody
  • ZNF654 polyclonal antibody

ZNF654 polyclonal antibody

Ref: AB-PAB22961
ZNF654 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF654.
Información adicional
Size 100 uL
Gene Name ZNF654
Gene Alias FLJ10997|FLJ21142
Gene Description zinc finger protein 654
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YDLNQETSVIHKINGTVCHPKDIYATDQEGNFKCPALGCVRIFKRIGFLNKHAMTVHPTDLNVRQTVMKWSKG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF654.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55279
Iso type IgG

Enviar uma mensagem


ZNF654 polyclonal antibody

ZNF654 polyclonal antibody