ANKAR polyclonal antibody
  • ANKAR polyclonal antibody

ANKAR polyclonal antibody

Ref: AB-PAB22960
ANKAR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKAR.
Información adicional
Size 100 uL
Gene Name ANKAR
Gene Alias FLJ25415
Gene Description ankyrin and armadillo repeat containing
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QLPPAYYDTRIGQILINIDYMLKALWHGIYMPKEKRARFSELWRAIMDIDPDGKPQTNKDIFSEFSSAGLTDITKDPDFNEIYDEDVNEDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKAR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 150709
Iso type IgG

Enviar uma mensagem


ANKAR polyclonal antibody

ANKAR polyclonal antibody