FAM126B polyclonal antibody
  • FAM126B polyclonal antibody

FAM126B polyclonal antibody

Ref: AB-PAB22959
FAM126B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM126B.
Información adicional
Size 100 uL
Gene Name FAM126B
Gene Alias FLJ10981|FLJ37917|FLJ42947|HYCC2|MGC39518
Gene Description family with sequence similarity 126, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PFDAPDSTQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGVNGGEESVNLNDADEGFSSGASLSSQPIGTKPSSSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM126B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 285172
Iso type IgG

Enviar uma mensagem


FAM126B polyclonal antibody

FAM126B polyclonal antibody