MITD1 polyclonal antibody
  • MITD1 polyclonal antibody

MITD1 polyclonal antibody

Ref: AB-PAB22958
MITD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MITD1.
Información adicional
Size 100 uL
Gene Name MITD1
Gene Alias -
Gene Description MIT, microtubule interacting and transport, domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MITD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 129531
Iso type IgG

Enviar uma mensagem


MITD1 polyclonal antibody

MITD1 polyclonal antibody