IL1RAPL2 polyclonal antibody
  • IL1RAPL2 polyclonal antibody

IL1RAPL2 polyclonal antibody

Ref: AB-PAB22951
IL1RAPL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IL1RAPL2.
Información adicional
Size 100 uL
Gene Name IL1RAPL2
Gene Alias IL-1R9|IL1R9|IL1RAPL-2|TIGIRR-1
Gene Description interleukin 1 receptor accessory protein-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TTELKVTALLTDKPPKPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEIRLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IL1RAPL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26280
Iso type IgG

Enviar uma mensagem


IL1RAPL2 polyclonal antibody

IL1RAPL2 polyclonal antibody